PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 208aa    MW: 24134.3 Da    PI: 6.5292
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-41782PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.7e-2055107456
                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                ++++++eq++ Le+ F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Lsa008209  55 KRKLSDEQVNLLEQNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWK 107
                45899***********************************************9 PP

2HD-ZIP_I/II120.31e-3854145293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +kr+ls+eqv+lLE++F +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++d+ + e+++Le+e  +L+e+l+e
    Lsa008209  54 RKRKLSDEQVNLLEQNFGNEHKLESERKDRLASELGLDPRQVAVWFQNRRARWKSKKLEEEYSKLKSQHDSTVLEKCQLESEILKLKEQLSE 145
                  8****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.24849109IPR001356Homeobox domain
SMARTSM003891.4E-1852113IPR001356Homeobox domain
SuperFamilySSF466894.19E-1853118IPR009057Homeodomain-like
CDDcd000865.03E-1654110No hitNo description
PfamPF000466.2E-1755107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-2156116IPR009057Homeodomain-like
PRINTSPR000311.3E-58089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000311.3E-589105IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MTSNMKTQVD DQMVLLSQYY PGIYDQLIPE QGEVVKPRRR RKKNKADGNS SMMRKRKLSD  60
EQVNLLEQNF GNEHKLESER KDRLASELGL DPRQVAVWFQ NRRARWKSKK LEEEYSKLKS  120
QHDSTVLEKC QLESEILKLK EQLSEAEKQI NSLVERSDGI SSTSPCSSFS MEAMEPHFLG  180
GFGMEGLENV FCLPENNYIH GSLDWMNI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13856RRRKKNKADGNSSMMRKRK
24056RKKNKADGNSSMMRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065260.11e-90PREDICTED: homeobox-leucine zipper protein ATHB-40
SwissprotO232086e-73ATB40_ARATH; Homeobox-leucine zipper protein ATHB-40
TrEMBLA0A103Y5781e-119A0A103Y578_CYNCS; Helix-turn-helix motif-containing protein
STRINGSolyc02g085630.2.11e-88(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-57homeobox protein 40